(data stored in ACNUC1104 zone)

EMBL: CP000959.PE455

CP000959.PE455       Location/Qualifiers
FT   CDS             complement(545676..545888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3644"
FT                   /product="ribosomal protein S21"
FT                   /note="PFAM: ribosomal protein S21; KEGG:
FT                   bur:Bcep18194_B2207 30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3644"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92796"
FT                   /db_xref="GOA:B1K3S5"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3S5"
FT                   /protein_id="ACA92796.1"
FT                   /translation="MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAER
FT                   KRKKAAAVKRHYKRIRSQTLPKKLY"
     MTIIRVKENE PFEVAMRRFK RTIEKNGLLT ELRAREFYEK PTAERKRKKA AAVKRHYKRI        60
     RSQTLPKKLY                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page