(data stored in ACNUC1104 zone)

EMBL: CP000959.PE461

CP000959.PE461       Location/Qualifiers
FT   CDS             complement(552310..552603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3650"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII small subunit; KEGG:
FT                   bur:Bcep18194_B2213 exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3650"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92802"
FT                   /db_xref="GOA:B1K3T1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1K3T1"
FT                   /protein_id="ACA92802.1"
FT                   /translation="MAKTASPGATPPGNGTEPLPDNYEMALAELETLVARMEGGALSLE
FT                   DSLAAYRRGATLVAFCQQQLEKVEQQVRVLDGATLKPLSSGTAATDGEDDDL"
     MAKTASPGAT PPGNGTEPLP DNYEMALAEL ETLVARMEGG ALSLEDSLAA YRRGATLVAF        60
     CQQQLEKVEQ QVRVLDGATL KPLSSGTAAT DGEDDDL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page