(data stored in ACNUC1104 zone)

EMBL: CP000959.PE470

CP000959.PE470       Location/Qualifiers
FT   CDS             563871..564266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3659"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3659"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92811"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3U0"
FT                   /protein_id="ACA92811.1"
FT                   /translation="MKPLIFVAAAVAFAAASVAHAAGGTPDADAQARAEANEAAGLPDL
FT                   RKINRPGAEVTSKVDFADIRRTPSFHEKSKNGTEVTEYRDRGKPVEIDVKSNFGTRYQM
FT                   SSTPDTSPKPHDAGIPITRLPSLNLRY"
     MKPLIFVAAA VAFAAASVAH AAGGTPDADA QARAEANEAA GLPDLRKINR PGAEVTSKVD        60
     FADIRRTPSF HEKSKNGTEV TEYRDRGKPV EIDVKSNFGT RYQMSSTPDT SPKPHDAGIP       120
     ITRLPSLNLR Y                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page