(data stored in ACNUC1104 zone)

EMBL: CP000959.PE473

CP000959.PE473       Location/Qualifiers
FT   CDS             566353..566805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3662"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bur:Bcep18194_B2231 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92814"
FT                   /db_xref="GOA:B1K3U3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3U3"
FT                   /protein_id="ACA92814.1"
FT                   /translation="MDRLPPLPQTLDEQLCFALYSTSHAMTKAYKPLLDKLSLTYPQYL
FT                   AMLVLWERDDMAVKDIAARLDLDPATVTPLLKRLEALGYVERVRSAADERVVNVRVTPE
FT                   GRALKDRARSVPADLFCAMQQTPEFLIRLRADLQQLRDALSVANER"
     MDRLPPLPQT LDEQLCFALY STSHAMTKAY KPLLDKLSLT YPQYLAMLVL WERDDMAVKD        60
     IAARLDLDPA TVTPLLKRLE ALGYVERVRS AADERVVNVR VTPEGRALKD RARSVPADLF       120
     CAMQQTPEFL IRLRADLQQL RDALSVANER                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page