(data stored in ACNUC1104 zone)

EMBL: CP000959.PE48

CP000959.PE48        Location/Qualifiers
FT   CDS             58172..58771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3233"
FT                   /product="nitrile hydratase, alpha subunit"
FT                   /EC_number="4.2.1.84"
FT                   /note="KEGG: bam:Bamb_6544 nitrile hydratase, alpha
FT                   subunit; TIGRFAM: nitrile hydratase, alpha subunit; PFAM:
FT                   Nitrile hydratase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92389"
FT                   /db_xref="GOA:B1K8P2"
FT                   /db_xref="InterPro:IPR004232"
FT                   /db_xref="InterPro:IPR018141"
FT                   /db_xref="InterPro:IPR023900"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8P2"
FT                   /protein_id="ACA92389.1"
FT                   /translation="MNTIPSEETVSTPGERAWALFRVMKEKNLIPDGYIDTLTELMSTT
FT                   WDPANGARIVARAWVDPAFRELLLKDGTAACAQFGYTGPQGEYIVALEDTPTLKNVIVC
FT                   SLCSCTNWPVLGLPPEWYKGFEYRARLVREGRTVLRELGTDLPDDVVVKVWDTTAESRY
FT                   LVLPVRPAGSEHMTEEQLRALVTKDVLIGVALPRAH"
     MNTIPSEETV STPGERAWAL FRVMKEKNLI PDGYIDTLTE LMSTTWDPAN GARIVARAWV        60
     DPAFRELLLK DGTAACAQFG YTGPQGEYIV ALEDTPTLKN VIVCSLCSCT NWPVLGLPPE       120
     WYKGFEYRAR LVREGRTVLR ELGTDLPDDV VVKVWDTTAE SRYLVLPVRP AGSEHMTEEQ       180
     LRALVTKDVL IGVALPRAH                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page