(data stored in ACNUC1104 zone)

EMBL: CP000959.PE481

CP000959.PE481       Location/Qualifiers
FT   CDS             complement(572346..573182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3670"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein LysR; TOBE domain protein;
FT                   KEGG: bur:Bcep18194_B2239 transcriptional regulator, ModE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3670"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92822"
FT                   /db_xref="GOA:B1K4A4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4A4"
FT                   /protein_id="ACA92822.1"
FT                   /translation="MTDVPPSSSSAGPLELGGELWLRAGEQTLGGATRIALLAAIGDTG
FT                   SITRAAKAVGLSYKAAWDAVDTMNNLAGEPLVARSTGGKGGGGTTLTPRATSLIAAFRT
FT                   IEREHRRFIEAASAAVAGFDVDWALIGRIGMKTSARNQLFGKVASLVRGTVNDEVTLAL
FT                   PGGQAVVAVLTHESAEALGLREGAHACALVKASWVVLAVDDGGPDLKVSARNRLHGSVE
FT                   AVAAGAVNSEVTLALDGGGTLTAVVTNDSVDALQLAAGRRAIALFKASSVILAVTG"
     MTDVPPSSSS AGPLELGGEL WLRAGEQTLG GATRIALLAA IGDTGSITRA AKAVGLSYKA        60
     AWDAVDTMNN LAGEPLVARS TGGKGGGGTT LTPRATSLIA AFRTIEREHR RFIEAASAAV       120
     AGFDVDWALI GRIGMKTSAR NQLFGKVASL VRGTVNDEVT LALPGGQAVV AVLTHESAEA       180
     LGLREGAHAC ALVKASWVVL AVDDGGPDLK VSARNRLHGS VEAVAAGAVN SEVTLALDGG       240
     GTLTAVVTND SVDALQLAAG RRAIALFKAS SVILAVTG                               278
//

If you have problems or comments...

PBIL Back to PBIL home page