(data stored in ACNUC1104 zone)

EMBL: CP000959.PE482

CP000959.PE482       Location/Qualifiers
FT   CDS             complement(573236..574858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3671"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   bur:Bcep18194_B2240 conserved hypothetical protein, CHAD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3671"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92823"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4A5"
FT                   /protein_id="ACA92823.1"
FT                   /translation="MSRVLEIVLSLSLEGWPVKGASRARGAQRDFGAELVRAWRICPQV
FT                   RMRRGHERVTVEPCQIEEAERSPGASWWTWVESNAHGTRVVASRTRTFAPGVTQRELFD
FT                   AEHAGIVVATPLPVPATAGAADTDAPPAAETDGVAPDTDEARAQASALRLVSERRRGRW
FT                   ADDSGVVVEMTLDDITLHGGGEPPRRHVELRLAAPDWETVAARTAALHALFAAARELSG
FT                   AWPAFVQLTSVIDRACAGGPVAATLVKAQPVDLTGIRTQRAALFALSGDITAQWLGNEC
FT                   GVLDRDDPEFVHQMRVALRRLRTLMRFFPRFTDRQWRDTLGVDLRWLAKLLGTVRDWDV
FT                   FATESLPALIAADGGSSDWDGTLDAARAQSMAARVELRQALHSARYARLTLGWLEWLSA
FT                   LALPAADGDDAPSLRRHATKRVRRLFGHLYGSPSLTSLDTAARHQVRIDAKRLRYALEF
FT                   FASLASRRTRTETVKTLARVQSVLGEANDAMVALRHLEQLAAPPYQLGFVRGYGAALEQ
FT                   RAARDAETLLASLRPPKLDGKPG"
     MSRVLEIVLS LSLEGWPVKG ASRARGAQRD FGAELVRAWR ICPQVRMRRG HERVTVEPCQ        60
     IEEAERSPGA SWWTWVESNA HGTRVVASRT RTFAPGVTQR ELFDAEHAGI VVATPLPVPA       120
     TAGAADTDAP PAAETDGVAP DTDEARAQAS ALRLVSERRR GRWADDSGVV VEMTLDDITL       180
     HGGGEPPRRH VELRLAAPDW ETVAARTAAL HALFAAAREL SGAWPAFVQL TSVIDRACAG       240
     GPVAATLVKA QPVDLTGIRT QRAALFALSG DITAQWLGNE CGVLDRDDPE FVHQMRVALR       300
     RLRTLMRFFP RFTDRQWRDT LGVDLRWLAK LLGTVRDWDV FATESLPALI AADGGSSDWD       360
     GTLDAARAQS MAARVELRQA LHSARYARLT LGWLEWLSAL ALPAADGDDA PSLRRHATKR       420
     VRRLFGHLYG SPSLTSLDTA ARHQVRIDAK RLRYALEFFA SLASRRTRTE TVKTLARVQS       480
     VLGEANDAMV ALRHLEQLAA PPYQLGFVRG YGAALEQRAA RDAETLLASL RPPKLDGKPG       540
//

If you have problems or comments...

PBIL Back to PBIL home page