(data stored in ACNUC1104 zone)

EMBL: CP000959.PE485

CP000959.PE485       Location/Qualifiers
FT   CDS             576393..577316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3674"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bmu:Bmul_4892 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3674"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92826"
FT                   /db_xref="GOA:B1K4A8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4A8"
FT                   /protein_id="ACA92826.1"
FT                   /translation="MKPDARKHLRANLLMLGAAAIWGSAFVAQRLSLDVIGPFLFTGLR
FT                   FLLGALVLVPLLMVNAASRAQLAAIRREPALLLPGLALGGLLAVSISLQQVGLQYTRIA
FT                   NAGFISSLYVVIVPLMGALARHRIGAGTWFGALLAAIGLYFLSIDEHFSVLYGDWFQLA
FT                   GAVIIAAHVMAVGHLAKRHDPLVLAFLQFAVCGVACLAVGLAVEPVSAAMLRGALPTLL
FT                   YGGLLSVGVGYTLQVVAQRDAAPAHAAVIFSMEGVFAAIAGWAALGETLTLRALVGCAL
FT                   MLAGLLACQLLPNGDARKKDEDALPA"
     MKPDARKHLR ANLLMLGAAA IWGSAFVAQR LSLDVIGPFL FTGLRFLLGA LVLVPLLMVN        60
     AASRAQLAAI RREPALLLPG LALGGLLAVS ISLQQVGLQY TRIANAGFIS SLYVVIVPLM       120
     GALARHRIGA GTWFGALLAA IGLYFLSIDE HFSVLYGDWF QLAGAVIIAA HVMAVGHLAK       180
     RHDPLVLAFL QFAVCGVACL AVGLAVEPVS AAMLRGALPT LLYGGLLSVG VGYTLQVVAQ       240
     RDAAPAHAAV IFSMEGVFAA IAGWAALGET LTLRALVGCA LMLAGLLACQ LLPNGDARKK       300
     DEDALPA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page