(data stored in ACNUC1104 zone)

EMBL: CP000959.PE487

CP000959.PE487       Location/Qualifiers
FT   CDS             578240..579583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3676"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: bur:Bcep18194_B2245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3676"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92828"
FT                   /db_xref="GOA:B1K4B0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B0"
FT                   /protein_id="ACA92828.1"
FT                   /translation="MLQIFALIGALFLVALNGFFVAAEFGLVKLRATRVKTLARKHGLR
FT                   GRILGIVHGRLDAYLSACQLGITLASLGLGWVGEPAFAQLLGPLLDLIGVHSERVVHLI
FT                   SLVFAFSLISFLHIVVGELAPKSMAIRQPEKVGLWVALPLYAFYWAMYPAIWVLNTSAN
FT                   AVLRLAGLSADHGGDAHYSTDELKLILRSRRSAAGNAAQPARGTYTNDEWNTLAHSLDF
FT                   SSMTVSDLMRPAHEMIGLRRDLPLPDNMEIVARHRFSRYPLFEDASREQVSGLIHLKDL
FT                   LLARHAGAALEDLSDYVRPVQYVKPDTPALELFRRFREGAPHFALVGNKGEKPIGFLTL
FT                   DNLLGALVGQIHDEFRQGDADWSRLDDGTLMGKGSLPVVSLEQALGIDIDEGRAESVGG
FT                   LVIQALSDLPTEGQRVSFDRFDVVVKKMNGPRIVLVRVYPKIVKEADE"
     MLQIFALIGA LFLVALNGFF VAAEFGLVKL RATRVKTLAR KHGLRGRILG IVHGRLDAYL        60
     SACQLGITLA SLGLGWVGEP AFAQLLGPLL DLIGVHSERV VHLISLVFAF SLISFLHIVV       120
     GELAPKSMAI RQPEKVGLWV ALPLYAFYWA MYPAIWVLNT SANAVLRLAG LSADHGGDAH       180
     YSTDELKLIL RSRRSAAGNA AQPARGTYTN DEWNTLAHSL DFSSMTVSDL MRPAHEMIGL       240
     RRDLPLPDNM EIVARHRFSR YPLFEDASRE QVSGLIHLKD LLLARHAGAA LEDLSDYVRP       300
     VQYVKPDTPA LELFRRFREG APHFALVGNK GEKPIGFLTL DNLLGALVGQ IHDEFRQGDA       360
     DWSRLDDGTL MGKGSLPVVS LEQALGIDID EGRAESVGGL VIQALSDLPT EGQRVSFDRF       420
     DVVVKKMNGP RIVLVRVYPK IVKEADE                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page