(data stored in ACNUC1104 zone)

EMBL: CP000959.PE489

CP000959.PE489       Location/Qualifiers
FT   CDS             complement(580263..581915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3678"
FT                   /product="glycoside hydrolase family 13 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 13 domain protein;
FT                   KEGG: bur:Bcep18194_B2247 glycoside hydrolase, family
FT                   13-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3678"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92830"
FT                   /db_xref="GOA:B1K4B2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B2"
FT                   /protein_id="ACA92830.1"
FT                   /translation="MSDCPHDPYAQHYIHCLPFGAQPCGALSTTPRTHFRVWAPGSTHV
FT                   QLELNTGYGPMLVPMTSAGPNWFEVFVDCGAGARYRYRLDDTVSIPDPASRSQPEGLNG
FT                   PSEVVDPRAFTWRNTFWHGRAWEDVALYAIRPHAVGGFDAVRRRLPQLARLGVTALELL
FT                   ASPHDSLPFAPLAAEGGPDELKALIDAAHGYGLAVLLELDYARFGSGTDALRHYAGPFF
FT                   HTRDDPLQAAPLALDHPEVCDFFCDNALYWIDEYRCDGLRLREADRIGVSWLREIADRV
FT                   RAAVPADRLIHLVLGSERHPAHLADTHFDAQWNGCGERALHRLTGRDPSAHEGISAHQS
FT                   IHTLARALTAAGAAYQPAASSDGMGADGGLSLTSLVLSDGAWRDGGPGDPGQAAGLAAL
FT                   ALSLLTPQIPLIFDETARDIDRAHFVQSALAVRAKLIAPRLSDCRPQAAHALKADGDGD
FT                   ADALCASWRLADDETLTIALNLSPDAVPFDAPGGRVVFETPARARDRVDEGELPPYSLV
FT                   AWLTGDVNRYALTHDVRRLDDGSWRGMRPNLNA"
     MSDCPHDPYA QHYIHCLPFG AQPCGALSTT PRTHFRVWAP GSTHVQLELN TGYGPMLVPM        60
     TSAGPNWFEV FVDCGAGARY RYRLDDTVSI PDPASRSQPE GLNGPSEVVD PRAFTWRNTF       120
     WHGRAWEDVA LYAIRPHAVG GFDAVRRRLP QLARLGVTAL ELLASPHDSL PFAPLAAEGG       180
     PDELKALIDA AHGYGLAVLL ELDYARFGSG TDALRHYAGP FFHTRDDPLQ AAPLALDHPE       240
     VCDFFCDNAL YWIDEYRCDG LRLREADRIG VSWLREIADR VRAAVPADRL IHLVLGSERH       300
     PAHLADTHFD AQWNGCGERA LHRLTGRDPS AHEGISAHQS IHTLARALTA AGAAYQPAAS       360
     SDGMGADGGL SLTSLVLSDG AWRDGGPGDP GQAAGLAALA LSLLTPQIPL IFDETARDID       420
     RAHFVQSALA VRAKLIAPRL SDCRPQAAHA LKADGDGDAD ALCASWRLAD DETLTIALNL       480
     SPDAVPFDAP GGRVVFETPA RARDRVDEGE LPPYSLVAWL TGDVNRYALT HDVRRLDDGS       540
     WRGMRPNLNA                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page