(data stored in ACNUC1104 zone)

EMBL: CP000959.PE49

CP000959.PE49        Location/Qualifiers
FT   CDS             58816..59469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3234"
FT                   /product="Nitrile hydratase"
FT                   /EC_number="4.2.1.84"
FT                   /note="PFAM: nitrile hydratase beta subunit; KEGG:
FT                   bam:Bamb_6543 nitrile hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92390"
FT                   /db_xref="GOA:B1K8P3"
FT                   /db_xref="InterPro:IPR003168"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="InterPro:IPR024690"
FT                   /db_xref="InterPro:IPR042262"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8P3"
FT                   /protein_id="ACA92390.1"
FT                   /translation="MDGFHDLGGFQGFGPVPHTINSLGYKPVFKEDWEHLAYSLMFVGV
FT                   DQLKKFSVDEVRHAVERIDVRQHVGTRYYERYVIATATLLVETGVLTQDELDRALGSHF
FT                   RLANPPRSAGRAAPPESTRFEVGDRVVVRDEYVSGHIRAPGYVRGKAGVVLHRTTESWP
FT                   FPDAIGHGDTGAVHQPTYHVEFRVKDLWGDAADDGYVVVDLFEGYLDRASGQSA"
     MDGFHDLGGF QGFGPVPHTI NSLGYKPVFK EDWEHLAYSL MFVGVDQLKK FSVDEVRHAV        60
     ERIDVRQHVG TRYYERYVIA TATLLVETGV LTQDELDRAL GSHFRLANPP RSAGRAAPPE       120
     STRFEVGDRV VVRDEYVSGH IRAPGYVRGK AGVVLHRTTE SWPFPDAIGH GDTGAVHQPT       180
     YHVEFRVKDL WGDAADDGYV VVDLFEGYLD RASGQSA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page