(data stored in ACNUC1104 zone)

EMBL: CP000959.PE492

CP000959.PE492       Location/Qualifiers
FT   CDS             complement(583711..584364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3681"
FT                   /product="protein of unknown function DUF1345"
FT                   /note="PFAM: protein of unknown function DUF1345; KEGG:
FT                   bur:Bcep18194_B2250 protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3681"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92833"
FT                   /db_xref="GOA:B1K4B5"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B5"
FT                   /protein_id="ACA92833.1"
FT                   /translation="MTLYPQVLRNRPRMVAAFVAGVLCAVLLPFPLRPTARALIGWDCA
FT                   VWLYLVLMWVRMVTAHHHKVREVAVREDENATTVLTVVCLATVASVAAIAIELATAKSV
FT                   GFSAGLSHYAITGATLFGAWFLIPTIFTLHYARLYYGSPSNDRALRFPDRNPEPDYWDF
FT                   LYFAFTLAVASQTADVSLANRSARRSVLAQSILSFYFNMAVLGLSINVAAGLLS"
     MTLYPQVLRN RPRMVAAFVA GVLCAVLLPF PLRPTARALI GWDCAVWLYL VLMWVRMVTA        60
     HHHKVREVAV REDENATTVL TVVCLATVAS VAAIAIELAT AKSVGFSAGL SHYAITGATL       120
     FGAWFLIPTI FTLHYARLYY GSPSNDRALR FPDRNPEPDY WDFLYFAFTL AVASQTADVS       180
     LANRSARRSV LAQSILSFYF NMAVLGLSIN VAAGLLS                                217
//

If you have problems or comments...

PBIL Back to PBIL home page