(data stored in ACNUC1104 zone)

EMBL: CP000959.PE494

CP000959.PE494       Location/Qualifiers
FT   CDS             complement(585290..585991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3683"
FT                   /product="RES domain protein"
FT                   /note="PFAM: RES domain protein; KEGG: bam:Bamb_5567
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3683"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92835"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B7"
FT                   /protein_id="ACA92835.1"
FT                   /translation="MTTPIEVTRWPTTTVDWAPAYRVIPTRFPAINLFDRVASADDFDA
FT                   LYALESLTNDRIRNEVGTLELVPPAERRYGQGWGPIMAAFTHLNPLGSRFSDGSYGVFY
FT                   CTRSRDTAIAETRYHSGLFLAATKEPPMRQQMRLYTVLAHGDVADVRTWPQRDPALLDP
FT                   VDYSAGQAFGRAVRQAGGAGIVYPSVRDPRGECLAAFRTTLLRDCQHAAYLEYNWNGSA
FT                   VDAVFELNQVG"
     MTTPIEVTRW PTTTVDWAPA YRVIPTRFPA INLFDRVASA DDFDALYALE SLTNDRIRNE        60
     VGTLELVPPA ERRYGQGWGP IMAAFTHLNP LGSRFSDGSY GVFYCTRSRD TAIAETRYHS       120
     GLFLAATKEP PMRQQMRLYT VLAHGDVADV RTWPQRDPAL LDPVDYSAGQ AFGRAVRQAG       180
     GAGIVYPSVR DPRGECLAAF RTTLLRDCQH AAYLEYNWNG SAVDAVFELN QVG              233
//

If you have problems or comments...

PBIL Back to PBIL home page