(data stored in ACNUC1104 zone)

EMBL: CP000959.PE495

CP000959.PE495       Location/Qualifiers
FT   CDS             complement(585988..586407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3684"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3684"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92836"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B8"
FT                   /protein_id="ACA92836.1"
FT                   /translation="MSQPAYESHSALPHASVAQMSAAGLRAFFNIARDWELTIDEQIVL
FT                   LGSPGRSTFFKWKAAPESARLPRDTLERLSLLLGIYKGLQILLPQPAAADAWVKRPNDA
FT                   APFGGKRALDRMLAGNVGDLVAVRQYLDAMRGGWA"
     MSQPAYESHS ALPHASVAQM SAAGLRAFFN IARDWELTID EQIVLLGSPG RSTFFKWKAA        60
     PESARLPRDT LERLSLLLGI YKGLQILLPQ PAAADAWVKR PNDAAPFGGK RALDRMLAGN       120
     VGDLVAVRQY LDAMRGGWA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page