(data stored in ACNUC1104 zone)

EMBL: CP000959.PE496

CP000959.PE496       Location/Qualifiers
FT   CDS             586642..587424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3685"
FT                   /product="cationic amino acid ABC transporter, periplasmic
FT                   binding protein"
FT                   /note="TIGRFAM: cationic amino acid ABC transporter,
FT                   periplasmic binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; KEGG: bur:Bcep18194_B2254
FT                   ABC amino acid transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3685"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92837"
FT                   /db_xref="GOA:B1K4B9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B9"
FT                   /protein_id="ACA92837.1"
FT                   /translation="MKRLIAAVSIALLAVSAGPAVAKDWTTIRFGTDASYAPFESKAPD
FT                   GKLVGFDIDLGNEICARLKAKCVWLENDFDGMIPALKAKKFDAVLSSMSITPQRAQQIG
FT                   FTTKIYNQPTRLVVKKGSSLLPTAASLKGKSIGVEQGTTQETYAKAYWGKQGANVVSYQ
FT                   NQDGVYADLIAGRLDAALQDEVQAAIGFLKSPRGANYTFVGPELVDEKVLGIGAGIGLR
FT                   QEDTDLKAKIDRAIHDMVKDGTYKRLASKYFDFDIYGG"
     MKRLIAAVSI ALLAVSAGPA VAKDWTTIRF GTDASYAPFE SKAPDGKLVG FDIDLGNEIC        60
     ARLKAKCVWL ENDFDGMIPA LKAKKFDAVL SSMSITPQRA QQIGFTTKIY NQPTRLVVKK       120
     GSSLLPTAAS LKGKSIGVEQ GTTQETYAKA YWGKQGANVV SYQNQDGVYA DLIAGRLDAA       180
     LQDEVQAAIG FLKSPRGANY TFVGPELVDE KVLGIGAGIG LRQEDTDLKA KIDRAIHDMV       240
     KDGTYKRLAS KYFDFDIYGG                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page