(data stored in ACNUC1104 zone)

EMBL: CP000959.PE497

CP000959.PE497       Location/Qualifiers
FT   CDS             588509..588895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3686"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bur:Bcep18194_B2257
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92838"
FT                   /db_xref="GOA:B1K4C0"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4C0"
FT                   /protein_id="ACA92838.1"
FT                   /translation="MIRTFHAAERARLIRFGVSGVGSTALHALIAAAMFALFDATPVIA
FT                   NATAFVCSTAFSYLANTLWSFSSPVTWGNFVRFLAVAMAGLAVTMLLAHGTDALGLARA
FT                   WSIVAVVLCVPPVTFVLHRLWTYR"
     MIRTFHAAER ARLIRFGVSG VGSTALHALI AAAMFALFDA TPVIANATAF VCSTAFSYLA        60
     NTLWSFSSPV TWGNFVRFLA VAMAGLAVTM LLAHGTDALG LARAWSIVAV VLCVPPVTFV       120
     LHRLWTYR                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page