(data stored in ACNUC1104 zone)

EMBL: CP000959.PE498

CP000959.PE498       Location/Qualifiers
FT   CDS             complement(588933..590423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3687"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B2258 sigma54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3687"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92839"
FT                   /db_xref="GOA:B1K4C1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4C1"
FT                   /protein_id="ACA92839.1"
FT                   /translation="MVARSPDANGPAAPEMTDVSVTAPEAGRKLFVIMRTPDEPLLAQL
FT                   RGLGWEITVAKTAGAAQNMTCGVSVAAGLVDFTGFTSRDYPALKMCLSQPAIGWISIAQ
FT                   AGITIGPAVRELIRSYCFDYVTLPLPYEWISHVLGHARGMAALDRVDGAAYAASIGEHG
FT                   MIGNCEAMQQLFSTIRKVAKTDASVFISGESGTGKELTALAIHERSGRGKGPFVAINCG
FT                   AIPHHLLQSELFGYERGAFTGANQRRAGRIESANGGTLFLDEIGDMPVESQASLLRFLQ
FT                   EGKIERLGGQESIVVDVRIISATHVDLDGAVEAGRFRADLYHRLCVLRIHEPPLRARGK
FT                   DIDILAHYVLQKFKADSGRKISGFTSAALDAMRRYEWPGNVRELINRVRRAIVMAESRL
FT                   LTPHDLGLDTPGETEPVTLEQARALAERTAIENALLRNDHRINKAAAELGISRVTLYRM
FT                   MIEHGLNDHDNNGGNGGNGDSGGHDGAPSGDAGHQRVG"
     MVARSPDANG PAAPEMTDVS VTAPEAGRKL FVIMRTPDEP LLAQLRGLGW EITVAKTAGA        60
     AQNMTCGVSV AAGLVDFTGF TSRDYPALKM CLSQPAIGWI SIAQAGITIG PAVRELIRSY       120
     CFDYVTLPLP YEWISHVLGH ARGMAALDRV DGAAYAASIG EHGMIGNCEA MQQLFSTIRK       180
     VAKTDASVFI SGESGTGKEL TALAIHERSG RGKGPFVAIN CGAIPHHLLQ SELFGYERGA       240
     FTGANQRRAG RIESANGGTL FLDEIGDMPV ESQASLLRFL QEGKIERLGG QESIVVDVRI       300
     ISATHVDLDG AVEAGRFRAD LYHRLCVLRI HEPPLRARGK DIDILAHYVL QKFKADSGRK       360
     ISGFTSAALD AMRRYEWPGN VRELINRVRR AIVMAESRLL TPHDLGLDTP GETEPVTLEQ       420
     ARALAERTAI ENALLRNDHR INKAAAELGI SRVTLYRMMI EHGLNDHDNN GGNGGNGDSG       480
     GHDGAPSGDA GHQRVG                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page