(data stored in ACNUC1104 zone)

EMBL: CP000959.PE499

CP000959.PE499       Location/Qualifiers
FT   CDS             complement(590879..591796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3688"
FT                   /product="metal-dependent hydrolase-like protein"
FT                   /note="KEGG: bur:Bcep18194_B2259 metal-dependent
FT                   hydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3688"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92840"
FT                   /db_xref="GOA:B1K4C2"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4C2"
FT                   /protein_id="ACA92840.1"
FT                   /translation="MKSAASATAAGIMPVRRDLRFDLPVERAKDWHGLGSHVTHFFNAL
FT                   SLLFPAGERFFMDSVRNYRDRIDDPVLKQQVLGFIGQEAMHTREHIEYNELMQANRLPA
FT                   RKLDQRVWTVLGYMKRKLPHSVQLAHTVAAEHYTAMLADWLLRDPTRLDGSVEGYRQMW
FT                   IWHALEETEHKAVSFDVWNAAMKPGLRRYLIRIGVYLLTTLTFWPTVFLMHATLLWRDR
FT                   GAGHHVRGMLRMIAFLYGPRRGLFPRIAGEWLSFFRPGFHPWDHDNHHHLARVDALAAT
FT                   YGEHGGTPAGRGRANAPAPLASGR"
     MKSAASATAA GIMPVRRDLR FDLPVERAKD WHGLGSHVTH FFNALSLLFP AGERFFMDSV        60
     RNYRDRIDDP VLKQQVLGFI GQEAMHTREH IEYNELMQAN RLPARKLDQR VWTVLGYMKR       120
     KLPHSVQLAH TVAAEHYTAM LADWLLRDPT RLDGSVEGYR QMWIWHALEE TEHKAVSFDV       180
     WNAAMKPGLR RYLIRIGVYL LTTLTFWPTV FLMHATLLWR DRGAGHHVRG MLRMIAFLYG       240
     PRRGLFPRIA GEWLSFFRPG FHPWDHDNHH HLARVDALAA TYGEHGGTPA GRGRANAPAP       300
     LASGR                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page