(data stored in ACNUC1104 zone)

EMBL: CP000959.PE5

CP000959.PE5         Location/Qualifiers
FT   CDS             4277..5209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3190"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bam:Bamb_3749 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3190"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92346"
FT                   /db_xref="GOA:B1K866"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1K866"
FT                   /protein_id="ACA92346.1"
FT                   /translation="MANARKVIITCAPTGAIHTPSMSPYLPVTPHEIETAAVAAAQAGA
FT                   AILHLHARNPSDGKPTQDPAVFAEFLPRIKAQTDAVINLTSGGSPHMTVDERLQPALHF
FT                   QPEVASLNMGSMNFGLYPMLERFRELKHPWEREHLEKSRDLVFKNTFADIETILTRCGA
FT                   NGTRFEFECYDISHLYNLAHFVDRGLAKPPFFVQSVFGLLGGIGAHPEDLMHMRRTADR
FT                   LFGSDYVWSILGAGRNQIPLATIGAAQGANVRVGLEDSLWIAPGKLAESSAAQVLKMRQ
FT                   VLEGLSLEIATPAEARAMLALKGGDAVNF"
     MANARKVIIT CAPTGAIHTP SMSPYLPVTP HEIETAAVAA AQAGAAILHL HARNPSDGKP        60
     TQDPAVFAEF LPRIKAQTDA VINLTSGGSP HMTVDERLQP ALHFQPEVAS LNMGSMNFGL       120
     YPMLERFREL KHPWEREHLE KSRDLVFKNT FADIETILTR CGANGTRFEF ECYDISHLYN       180
     LAHFVDRGLA KPPFFVQSVF GLLGGIGAHP EDLMHMRRTA DRLFGSDYVW SILGAGRNQI       240
     PLATIGAAQG ANVRVGLEDS LWIAPGKLAE SSAAQVLKMR QVLEGLSLEI ATPAEARAML       300
     ALKGGDAVNF                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page