(data stored in ACNUC1104 zone)

EMBL: CP000959.PE50

CP000959.PE50        Location/Qualifiers
FT   CDS             59466..60728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3235"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bam:Bamb_6542
FT                   cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92391"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8P4"
FT                   /protein_id="ACA92391.1"
FT                   /translation="MTTPGNRHVPAAPPPRIPVTVLSGFLGAGKTTLLNHILRNRAGLK
FT                   VAVIVNDMSEVNVDADDVRRNVELHRGEDELVEMTNGCICCTLRADLLEQISTLARQHR
FT                   FDYLLIESTGISEPMPVAETFAFLDRDGFSLSELARLDTLVTVVNGETFEDMIASAEPV
FT                   TRDAPLANGSDADPPRKLSDLLIEQVEYANVILVSRLDRIGHAGFARLRAILASLNPSA
FT                   RILPMQHGKVDPSDVLDTRRFDLPALVESPGWMQRMQADERPPESDAYGIASWVYRERA
FT                   PFHPARLLAWLRRRWTNGRLLRCKGYVWAAHRYAETAMLVQAGDTFQWGYVGRWWRFTP
FT                   PSDWPQDGYRREGVLKQWEEPAGDCRQEIVFIGQSIDHVQLRRELDACLLTVAEIDAGP
FT                   ESWRQLPEADAFDALATPAQP"
     MTTPGNRHVP AAPPPRIPVT VLSGFLGAGK TTLLNHILRN RAGLKVAVIV NDMSEVNVDA        60
     DDVRRNVELH RGEDELVEMT NGCICCTLRA DLLEQISTLA RQHRFDYLLI ESTGISEPMP       120
     VAETFAFLDR DGFSLSELAR LDTLVTVVNG ETFEDMIASA EPVTRDAPLA NGSDADPPRK       180
     LSDLLIEQVE YANVILVSRL DRIGHAGFAR LRAILASLNP SARILPMQHG KVDPSDVLDT       240
     RRFDLPALVE SPGWMQRMQA DERPPESDAY GIASWVYRER APFHPARLLA WLRRRWTNGR       300
     LLRCKGYVWA AHRYAETAML VQAGDTFQWG YVGRWWRFTP PSDWPQDGYR REGVLKQWEE       360
     PAGDCRQEIV FIGQSIDHVQ LRRELDACLL TVAEIDAGPE SWRQLPEADA FDALATPAQP       420
//

If you have problems or comments...

PBIL Back to PBIL home page