(data stored in ACNUC1104 zone)

EMBL: CP000959.PE501

CP000959.PE501       Location/Qualifiers
FT   CDS             592743..593516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3690"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_5558 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3690"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92842"
FT                   /db_xref="GOA:B1K4C4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4C4"
FT                   /protein_id="ACA92842.1"
FT                   /translation="MERIASPAIALRRYDTCEASDVHDFHQVVLGVDGAMVMAVDGIGR
FT                   RIDRHAAWLIPAGARHDYAGLGDNRQLVIDLPAASLAVPQRLFDHARAVSIDPALTSLV
FT                   AQVAAAAAQHDAPDGDARQAAAHRFQWQAAARLCDALLDDAGIAAPASGLDFARIDRWL
FT                   RARLADPLRIADLAAHCGYGMRRFHQLFVDAFGETPHRYLQRLRLDAAVVLLADGRHAL
FT                   VDIAGSVGFADQSTFTHAFTKRFGVAPGRWRGERH"
     MERIASPAIA LRRYDTCEAS DVHDFHQVVL GVDGAMVMAV DGIGRRIDRH AAWLIPAGAR        60
     HDYAGLGDNR QLVIDLPAAS LAVPQRLFDH ARAVSIDPAL TSLVAQVAAA AAQHDAPDGD       120
     ARQAAAHRFQ WQAAARLCDA LLDDAGIAAP ASGLDFARID RWLRARLADP LRIADLAAHC       180
     GYGMRRFHQL FVDAFGETPH RYLQRLRLDA AVVLLADGRH ALVDIAGSVG FADQSTFTHA       240
     FTKRFGVAPG RWRGERH                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page