(data stored in ACNUC1104 zone)

EMBL: CP000959.PE508

CP000959.PE508       Location/Qualifiers
FT   CDS             complement(600352..601818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3697"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3697"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92849"
FT                   /db_xref="GOA:B1K4D1"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4D1"
FT                   /protein_id="ACA92849.1"
FT                   /translation="MSTIAAERAPSRARSWFAEPKHWAGQAGLWALTAALIAIHQGKVL
FT                   TLAFPVLAIGVGIWLYFKSPARYVGFMWWVWFLSPEVRRLADWSKGAFTPTSLIQVAPL
FT                   AVTMIAGLGLVRHYRVLAQRRGIPVLLILFGLVYAYLVGIVSSGVMAATYDLANWLYPI
FT                   LIGFHIMVNARNYPEYRDVLLSTFMWGMLVMGLYGVVQYFVMPQWDVLWMVGSQMGSQG
FT                   EPVPYGVRVFSTMNSSGPFAFAMMGALVFVLVAPQKIRWFAGAAGFVSFALCLVRSTWG
FT                   GWVIALAIQLVQSSNRVRMRILISGVVLVGLCVPLLTVGPVADRLGARLQSITNLKDDR
FT                   SYDDRNKFYATFAQTAFTDVAGEGMGATGASTKLSSDSGELGKYGSFDSGVMNVPFVLG
FT                   WPGTLLYLAGVVMLFGRTLRAAFKLRKDKFVGACLSLCLSTFAMLVFTNSLIGTGGLLM
FT                   FTAIFSILAAAHWQKAQRLLAAARSRGGDH"
     MSTIAAERAP SRARSWFAEP KHWAGQAGLW ALTAALIAIH QGKVLTLAFP VLAIGVGIWL        60
     YFKSPARYVG FMWWVWFLSP EVRRLADWSK GAFTPTSLIQ VAPLAVTMIA GLGLVRHYRV       120
     LAQRRGIPVL LILFGLVYAY LVGIVSSGVM AATYDLANWL YPILIGFHIM VNARNYPEYR       180
     DVLLSTFMWG MLVMGLYGVV QYFVMPQWDV LWMVGSQMGS QGEPVPYGVR VFSTMNSSGP       240
     FAFAMMGALV FVLVAPQKIR WFAGAAGFVS FALCLVRSTW GGWVIALAIQ LVQSSNRVRM       300
     RILISGVVLV GLCVPLLTVG PVADRLGARL QSITNLKDDR SYDDRNKFYA TFAQTAFTDV       360
     AGEGMGATGA STKLSSDSGE LGKYGSFDSG VMNVPFVLGW PGTLLYLAGV VMLFGRTLRA       420
     AFKLRKDKFV GACLSLCLST FAMLVFTNSL IGTGGLLMFT AIFSILAAAH WQKAQRLLAA       480
     ARSRGGDH                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page