(data stored in ACNUC1104 zone)

EMBL: CP000959.PE509

CP000959.PE509       Location/Qualifiers
FT   CDS             complement(601829..602974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3698"
FT                   /product="glycosyltransferase-like protein"
FT                   /note="KEGG: bam:Bamb_5552 glycosyltransferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3698"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92850"
FT                   /db_xref="GOA:B1K4D2"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4D2"
FT                   /protein_id="ACA92850.1"
FT                   /translation="MTTKAATQVHVHLFYGADPRTYRKGDDIGCLYGYHHAESDEFRLT
FT                   YSQDVGENRVVSVARRALKAALGFDIVHAWRNRAALLATDVIWTHTEQEHLAAALILKL
FT                   AGAQGKRPLLLAQSVWLFDKWGSFGGPRRWLYRKLLARADALTTLARDNADLCRRYLGR
FT                   EAEFVYYGLNTQDFPPVEPRQWQPNRPLRIAAIGNDRDRDWRTFLAAFGGDERYEVRLA
FT                   TRRRVPREWHAPNVKIGPASGLAKQHELYAWADVIVVPLRPNFHASGITVMLEAAAVGK
FT                   PMIVSDVGGLSDYFPHDTAAYVPAFDAQAMRQAADRFVADPAAALDCARAAAACLRERD
FT                   LTTQAFAEQHVRITRDMLRRRRTPAPAGVAMPLADSSASSQ"
     MTTKAATQVH VHLFYGADPR TYRKGDDIGC LYGYHHAESD EFRLTYSQDV GENRVVSVAR        60
     RALKAALGFD IVHAWRNRAA LLATDVIWTH TEQEHLAAAL ILKLAGAQGK RPLLLAQSVW       120
     LFDKWGSFGG PRRWLYRKLL ARADALTTLA RDNADLCRRY LGREAEFVYY GLNTQDFPPV       180
     EPRQWQPNRP LRIAAIGNDR DRDWRTFLAA FGGDERYEVR LATRRRVPRE WHAPNVKIGP       240
     ASGLAKQHEL YAWADVIVVP LRPNFHASGI TVMLEAAAVG KPMIVSDVGG LSDYFPHDTA       300
     AYVPAFDAQA MRQAADRFVA DPAAALDCAR AAAACLRERD LTTQAFAEQH VRITRDMLRR       360
     RRTPAPAGVA MPLADSSASS Q                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page