(data stored in ACNUC1104 zone)

EMBL: CP000959.PE516

CP000959.PE516       Location/Qualifiers
FT   CDS             611255..612811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3705"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /note="KEGG: bur:Bcep18194_B2277 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase; Cupin 2 conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3705"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92857"
FT                   /db_xref="GOA:B1K4D9"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4D9"
FT                   /protein_id="ACA92857.1"
FT                   /translation="MNAPAVVAETRHSSSAAPAAGTPAAGMPAVGTRLAVQPVILAGGS
FT                   GTRLWPMSRERFPKQLIGLLGDHSLLQSTALRLDGLTADYPLNDDVLIVCGEDHRFTTA
FT                   EQLRLTARNATIMLEPLGRDTAPALTLAALRLVANGNDAVMTVMPADHAVADLPRFHAA
FT                   VAAGVHCAAQGKIATMGIVPKHAETGYGYIRVGAPLGDAGTGTLDVRRLDRFVEKPHLE
FT                   LAQQYVASGEYWWNSGIFIVRASVWLNAIRQLEPAIYAACAQAVAQGKEDGDFFRVDRD
FT                   AFAASPSNSIDYAVMEPLASQPQLCESVVVPLDAGWSDVGSWDAIWQISPKDESGNVGR
FT                   GHVLFEGADSTFAHSESRLVACVGTQNLVVVETPDAVLVADKSRVQDVKKIVGHIKARQ
FT                   GTEATDHRKVHRPWGHYDSVDTGERFQVKRIVVKPGAQLSLQMHHHRAEHWIVVRGTAR
FT                   ITRGDETFLLSENESTYIPLGVSHRLENPGKMPLELIEVQSGAYLGEDDIVRFDDTYGR
FT                   Q"
     MNAPAVVAET RHSSSAAPAA GTPAAGMPAV GTRLAVQPVI LAGGSGTRLW PMSRERFPKQ        60
     LIGLLGDHSL LQSTALRLDG LTADYPLNDD VLIVCGEDHR FTTAEQLRLT ARNATIMLEP       120
     LGRDTAPALT LAALRLVANG NDAVMTVMPA DHAVADLPRF HAAVAAGVHC AAQGKIATMG       180
     IVPKHAETGY GYIRVGAPLG DAGTGTLDVR RLDRFVEKPH LELAQQYVAS GEYWWNSGIF       240
     IVRASVWLNA IRQLEPAIYA ACAQAVAQGK EDGDFFRVDR DAFAASPSNS IDYAVMEPLA       300
     SQPQLCESVV VPLDAGWSDV GSWDAIWQIS PKDESGNVGR GHVLFEGADS TFAHSESRLV       360
     ACVGTQNLVV VETPDAVLVA DKSRVQDVKK IVGHIKARQG TEATDHRKVH RPWGHYDSVD       420
     TGERFQVKRI VVKPGAQLSL QMHHHRAEHW IVVRGTARIT RGDETFLLSE NESTYIPLGV       480
     SHRLENPGKM PLELIEVQSG AYLGEDDIVR FDDTYGRQ                               518
//

If you have problems or comments...

PBIL Back to PBIL home page