(data stored in ACNUC1104 zone)

EMBL: CP000959.PE517

CP000959.PE517       Location/Qualifiers
FT   CDS             complement(612930..613871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3706"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3706"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92858"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4E0"
FT                   /protein_id="ACA92858.1"
FT                   /translation="MFFDELNDEEWFRLSALIADEPIRLNRRGRPRAEPRVVANAVLWI
FT                   LTTGEAWSKLPGRYPSGPTCRRRYEEWLANGTLLKMIDVLTQFSGRTFAYIPPPPEAVV
FT                   PARRAEPVPDNDRLRGVFWQNPESWQLPVAQANVWEGEGASLSTLSADQVDGRADVSFA
FT                   VPGAPAAELRHVRASAASFAAAEPQVDEYRGYTISGIAQPVQNLMYRAWAEISQDDRRV
FT                   ERSGLIGPRFTDAEAAEQYALEWARQWIDRHGASDAPAREPQGEVLAGLSALARAESDI
FT                   KRFIAERRAGVLSESRNDPVQSERREYAYRVG"
     MFFDELNDEE WFRLSALIAD EPIRLNRRGR PRAEPRVVAN AVLWILTTGE AWSKLPGRYP        60
     SGPTCRRRYE EWLANGTLLK MIDVLTQFSG RTFAYIPPPP EAVVPARRAE PVPDNDRLRG       120
     VFWQNPESWQ LPVAQANVWE GEGASLSTLS ADQVDGRADV SFAVPGAPAA ELRHVRASAA       180
     SFAAAEPQVD EYRGYTISGI AQPVQNLMYR AWAEISQDDR RVERSGLIGP RFTDAEAAEQ       240
     YALEWARQWI DRHGASDAPA REPQGEVLAG LSALARAESD IKRFIAERRA GVLSESRNDP       300
     VQSERREYAY RVG                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page