(data stored in ACNUC1104 zone)

EMBL: CP000959.PE518

CP000959.PE518       Location/Qualifiers
FT   CDS             complement(614607..615188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3707"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3707"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92859"
FT                   /db_xref="InterPro:IPR021890"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4E1"
FT                   /protein_id="ACA92859.1"
FT                   /translation="MTLTRDSLLTLEAYAKIRKAEHARLVAYKRRRAVALGNHLRFLFE
FT                   DETTIRYQIHEMLHIEKIFDEAGIEGELEAYLPLVPDGTNLKATMQIEYEHEIERRAAL
FT                   ARLIGVEDRVYLQVDGYASVYAIADEDLERDNAEKTSAVHFVRFEFDAPMRAALKGGAA
FT                   LSIGCDHPAYTMPPQRVDADVAASLAGDLR"
     MTLTRDSLLT LEAYAKIRKA EHARLVAYKR RRAVALGNHL RFLFEDETTI RYQIHEMLHI        60
     EKIFDEAGIE GELEAYLPLV PDGTNLKATM QIEYEHEIER RAALARLIGV EDRVYLQVDG       120
     YASVYAIADE DLERDNAEKT SAVHFVRFEF DAPMRAALKG GAALSIGCDH PAYTMPPQRV       180
     DADVAASLAG DLR                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page