(data stored in ACNUC1104 zone)

EMBL: CP000959.PE52

CP000959.PE52        Location/Qualifiers
FT   CDS             complement(61516..62361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3237"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: bur:Bcep18194_B1732 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92393"
FT                   /db_xref="GOA:B1K8P6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8P6"
FT                   /protein_id="ACA92393.1"
FT                   /translation="MSRTANRSAVPSPFWRDTALPFIEARTVDDGRAICYAKHTHDTFS
FT                   VGAIVGGTSTYVNGATNAHVGRGVLVIIDPEQVHACNPYGPDAWAYRMVYVDVPWLARL
FT                   QHSLGGDPNRDFHGFSPKLTERGDLFARFGGFYRTLVSPDIDALGKESAAVEFFTALHG
FT                   ALDRELPDPRPGDDNAKLARAADYIAAHCREAVTLDAICAAADLSPSYLIRAFNARYGM
FT                   TPHAFLIDRRVQYGRTELRRGRPIAEVALDAGFADQAHFQRAFRRIAAATPGQYRGAMR
FT                   "
     MSRTANRSAV PSPFWRDTAL PFIEARTVDD GRAICYAKHT HDTFSVGAIV GGTSTYVNGA        60
     TNAHVGRGVL VIIDPEQVHA CNPYGPDAWA YRMVYVDVPW LARLQHSLGG DPNRDFHGFS       120
     PKLTERGDLF ARFGGFYRTL VSPDIDALGK ESAAVEFFTA LHGALDRELP DPRPGDDNAK       180
     LARAADYIAA HCREAVTLDA ICAAADLSPS YLIRAFNARY GMTPHAFLID RRVQYGRTEL       240
     RRGRPIAEVA LDAGFADQAH FQRAFRRIAA ATPGQYRGAM R                           281
//

If you have problems or comments...

PBIL Back to PBIL home page