(data stored in ACNUC1104 zone)

EMBL: CP000959.PE523

CP000959.PE523       Location/Qualifiers
FT   CDS             complement(619107..619526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3712"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG:
FT                   bur:Bcep18194_B2284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3712"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92864"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4E6"
FT                   /protein_id="ACA92864.1"
FT                   /translation="MRFMIMIRANAVSESDALPDNRLVEAMTVYHEELAKAGVLLDANG
FT                   LRPSAHGWRVRYTGGKGTVIDGPFAETKELIAGYTLIQVRSRDEALEWTRRFPAPFGAE
FT                   LDCEIEVRPLFELDDLTPSDAVERFRDLHVGRSHA"
     MRFMIMIRAN AVSESDALPD NRLVEAMTVY HEELAKAGVL LDANGLRPSA HGWRVRYTGG        60
     KGTVIDGPFA ETKELIAGYT LIQVRSRDEA LEWTRRFPAP FGAELDCEIE VRPLFELDDL       120
     TPSDAVERFR DLHVGRSHA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page