(data stored in ACNUC1104 zone)

EMBL: CP000959.PE527

CP000959.PE527       Location/Qualifiers
FT   CDS             622818..623402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3716"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3716"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92868"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F0"
FT                   /protein_id="ACA92868.1"
FT                   /translation="MQKSLAMKAAAAVMLGSLALAGCTTTPGKPDSAAASASKRQSIDA
FT                   SVNATLSRLYSTVPGSRDLVSKARGVLVFPNVLQAGFIVGAQSGNGALRVGGSTVGYYN
FT                   TSSLSVGLQAGAQSKAVVFLFMTQDALDSFRKSDGWSAGADASVAVVKVGANGAVDSNT
FT                   ATAPVEVLVLTNAGLMGDLSVNGTKVTKLNI"
     MQKSLAMKAA AAVMLGSLAL AGCTTTPGKP DSAAASASKR QSIDASVNAT LSRLYSTVPG        60
     SRDLVSKARG VLVFPNVLQA GFIVGAQSGN GALRVGGSTV GYYNTSSLSV GLQAGAQSKA       120
     VVFLFMTQDA LDSFRKSDGW SAGADASVAV VKVGANGAVD SNTATAPVEV LVLTNAGLMG       180
     DLSVNGTKVT KLNI                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page