(data stored in ACNUC1104 zone)

EMBL: CP000959.PE528

CP000959.PE528       Location/Qualifiers
FT   CDS             623638..624690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3717"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bam:Bamb_5533 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3717"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92869"
FT                   /db_xref="GOA:B1K4F1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F1"
FT                   /protein_id="ACA92869.1"
FT                   /translation="MDSGQDHQKFFYFLLFAVTVGLCWILAPFSGAVFWGTILAILFQP
FT                   VQRWLAARFGKRRNLAALVTMSLIILIVILPLVFVTATLVQEIAYVYQELKDAQPNYSQ
FT                   YFHDIIHALPTSIQNLLQKYGLTNIPGIQKKLTDGAAQISQFAATQALSIGQNTFQFVV
FT                   SFGVMLYMVFFLLRDGGEIGRRVRRALPLDEEHKNLLLAKFTTVVRATVKGNIAVALVQ
FT                   GALGGLIFWILGIEGVVLWGALMAFLSLLPAIGASLVWVPAALYFLMIGAVWKCVILVA
FT                   FCVGVIGLVDNLLRPILVGKDTKMPDWVVLISTLGGMALFGINGFVIGPLVAALFMASW
FT                   DIYARSEQGE"
     MDSGQDHQKF FYFLLFAVTV GLCWILAPFS GAVFWGTILA ILFQPVQRWL AARFGKRRNL        60
     AALVTMSLII LIVILPLVFV TATLVQEIAY VYQELKDAQP NYSQYFHDII HALPTSIQNL       120
     LQKYGLTNIP GIQKKLTDGA AQISQFAATQ ALSIGQNTFQ FVVSFGVMLY MVFFLLRDGG       180
     EIGRRVRRAL PLDEEHKNLL LAKFTTVVRA TVKGNIAVAL VQGALGGLIF WILGIEGVVL       240
     WGALMAFLSL LPAIGASLVW VPAALYFLMI GAVWKCVILV AFCVGVIGLV DNLLRPILVG       300
     KDTKMPDWVV LISTLGGMAL FGINGFVIGP LVAALFMASW DIYARSEQGE                  350
//

If you have problems or comments...

PBIL Back to PBIL home page