(data stored in ACNUC1104 zone)

EMBL: CP000959.PE529

CP000959.PE529       Location/Qualifiers
FT   CDS             complement(624734..625246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3718"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3718"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92870"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F2"
FT                   /protein_id="ACA92870.1"
FT                   /translation="MRNNAKRSASVTAMSAGAVRKRVFGLGIVLAMSIAMSSAMAAGQP
FT                   ASDGVVRFTGSLVDLYDVTLDAPVGALVDAGQAADGGATATVRFDAHGRRLPGAQVALV
FT                   KPDGAAFAPDDGTAVRATWRDAHTERSMPLAPGRVHRVGPYGGVMTVAADEATGAVAPV
FT                   VIHIRHP"
     MRNNAKRSAS VTAMSAGAVR KRVFGLGIVL AMSIAMSSAM AAGQPASDGV VRFTGSLVDL        60
     YDVTLDAPVG ALVDAGQAAD GGATATVRFD AHGRRLPGAQ VALVKPDGAA FAPDDGTAVR       120
     ATWRDAHTER SMPLAPGRVH RVGPYGGVMT VAADEATGAV APVVIHIRHP                  170
//

If you have problems or comments...

PBIL Back to PBIL home page