(data stored in ACNUC1104 zone)

EMBL: CP000959.PE533

CP000959.PE533       Location/Qualifiers
FT   CDS             complement(628428..629744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3722"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   bur:Bcep18194_B2294 manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3722"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92874"
FT                   /db_xref="GOA:B1K4F6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F6"
FT                   /protein_id="ACA92874.1"
FT                   /translation="MPFLPTTATAPFCPSEVKGSITIDAAAPRWQKLRRFFGPGLLVAI
FT                   GYMDPGNWATDIQAGSQFGYSLLWVVAFSSLAAIFLQMLAARLGLVAGKDLAQASYERY
FT                   GRFGRVVQWITAEVSIIACDIAEVLGCALAFKLLLGVPLAWGVVLTALDTVIVLGLQGK
FT                   GFRQIEAIVLGLIATMAFCFVAQVAITPPDWHAVVGGLVPGDPGHDRKDAIVLALGIVG
FT                   ATIMPHNLYLHSSVVQTRHVVGGARGVIRDTLALVRIDTCVSLFVAMLVNAAILVVAGA
FT                   AFHATGQHNVTDIEQAYRLITPIAGGAAALLFGIALLASGQSSTLTGTIAGQVIMDGFL
FT                   HTKIPCYQRRLITRGLALVPALIGVLWLGDGSVGQLLVWSQVLLSLQLPFAMWPLIRSV
FT                   SDRRTMGEHAIGRGMQVAAWALFAVITGTNLLLITGVAG"
     MPFLPTTATA PFCPSEVKGS ITIDAAAPRW QKLRRFFGPG LLVAIGYMDP GNWATDIQAG        60
     SQFGYSLLWV VAFSSLAAIF LQMLAARLGL VAGKDLAQAS YERYGRFGRV VQWITAEVSI       120
     IACDIAEVLG CALAFKLLLG VPLAWGVVLT ALDTVIVLGL QGKGFRQIEA IVLGLIATMA       180
     FCFVAQVAIT PPDWHAVVGG LVPGDPGHDR KDAIVLALGI VGATIMPHNL YLHSSVVQTR       240
     HVVGGARGVI RDTLALVRID TCVSLFVAML VNAAILVVAG AAFHATGQHN VTDIEQAYRL       300
     ITPIAGGAAA LLFGIALLAS GQSSTLTGTI AGQVIMDGFL HTKIPCYQRR LITRGLALVP       360
     ALIGVLWLGD GSVGQLLVWS QVLLSLQLPF AMWPLIRSVS DRRTMGEHAI GRGMQVAAWA       420
     LFAVITGTNL LLITGVAG                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page