(data stored in ACNUC1104 zone)

EMBL: CP000959.PE534

CP000959.PE534       Location/Qualifiers
FT   CDS             complement(629693..630811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3723"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_5527 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3723"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92875"
FT                   /db_xref="GOA:B1K4F7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F7"
FT                   /protein_id="ACA92875.1"
FT                   /translation="MNAADQRWVVIYLSTGFSLAQAARLGEAFNLANRLHAYSADYQLK
FT                   YVSESGGLLQSSSGVRIAAEPFGDEHSRRARAFFHLHGERAAVNWDDALQRRLSDIRQH
FT                   ARWIVDAMELPALAATRRPSSSIDVRPGRAGRRATTTIELQAGETDVFAAALDMFRVDL
FT                   GDGAAQEIASNMMRPVEQRYAQSMWAFRELSASPSIRMSAQRLRAQSVNRISIANAAQA
FT                   AAMSERNFLRRFKKEIGVTPTEFVQHVRLERACHMLIHTTLPADKVARRTGFGSGERLA
FT                   KLFRQRLLMSPTEFRVAEREKILAHGAASPDPDERLAAACCDGDGADCDACVAARGKTG
FT                   RIPVKSTDRDLDSRFPCPSSPLPPPPLSARRK"
     MNAADQRWVV IYLSTGFSLA QAARLGEAFN LANRLHAYSA DYQLKYVSES GGLLQSSSGV        60
     RIAAEPFGDE HSRRARAFFH LHGERAAVNW DDALQRRLSD IRQHARWIVD AMELPALAAT       120
     RRPSSSIDVR PGRAGRRATT TIELQAGETD VFAAALDMFR VDLGDGAAQE IASNMMRPVE       180
     QRYAQSMWAF RELSASPSIR MSAQRLRAQS VNRISIANAA QAAAMSERNF LRRFKKEIGV       240
     TPTEFVQHVR LERACHMLIH TTLPADKVAR RTGFGSGERL AKLFRQRLLM SPTEFRVAER       300
     EKILAHGAAS PDPDERLAAA CCDGDGADCD ACVAARGKTG RIPVKSTDRD LDSRFPCPSS       360
     PLPPPPLSAR RK                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page