(data stored in ACNUC1104 zone)

EMBL: CP000959.PE535

CP000959.PE535       Location/Qualifiers
FT   CDS             631253..632176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3724"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2296
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3724"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92876"
FT                   /db_xref="GOA:B1K4F8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F8"
FT                   /protein_id="ACA92876.1"
FT                   /translation="MPADHRLDLNLFRVLDAVYVHGGIGAAARALHLTQPAVTHALNRL
FT                   RAHFDDPLFVRQGNRVVPTERTRSIIADVQLHLKGLQGTARDPSAFDPATLDLSIAVGI
FT                   RDVLESIALPRIVAAFADEAPGLRLVSRRIAVPDIERELASGNLDLVVDRRVQTGPRIA
FT                   TEHLLDDSLVVALRRDHPLAHDPLRRGDYFAAQHIAVSSLGEPQSLDVLLGNDGRFRDI
FT                   RLTCQHYFAACQIAAAGNLLVTLPHTYALRMAALLPIVVRPLPLRLKPFPLLAYWHESR
FT                   DTDRAHQWVRERIATLVRSSAGIADA"
     MPADHRLDLN LFRVLDAVYV HGGIGAAARA LHLTQPAVTH ALNRLRAHFD DPLFVRQGNR        60
     VVPTERTRSI IADVQLHLKG LQGTARDPSA FDPATLDLSI AVGIRDVLES IALPRIVAAF       120
     ADEAPGLRLV SRRIAVPDIE RELASGNLDL VVDRRVQTGP RIATEHLLDD SLVVALRRDH       180
     PLAHDPLRRG DYFAAQHIAV SSLGEPQSLD VLLGNDGRFR DIRLTCQHYF AACQIAAAGN       240
     LLVTLPHTYA LRMAALLPIV VRPLPLRLKP FPLLAYWHES RDTDRAHQWV RERIATLVRS       300
     SAGIADA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page