(data stored in ACNUC1104 zone)

EMBL: CP000959.PE540

CP000959.PE540       Location/Qualifiers
FT   CDS             636810..637523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3729"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: bam:Bamb_5522 riboflavin
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3729"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92881"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4G3"
FT                   /protein_id="ACA92881.1"
FT                   /translation="MFTGIVQGVGTIDAIKDHGELRTFSIAFPERFTDDIEIGASVSVD
FT                   GVCLTVTTIHSPVLIDFDVMLPSLRITTLADLATGARVNVERAAKDGAEIGGHPLSGHV
FT                   DFTGTIAHIASSEHNRMIRIGVPAEFKRYVFAKGYIAINGCSLTVSDVNRDEGWFDVWL
FT                   IPETRRATTFDAKGVDDKVNIEIERSTQVVVDTIRESVKETLGELNGVVTALLAEKGID
FT                   IEELLARNVARLPKQ"
     MFTGIVQGVG TIDAIKDHGE LRTFSIAFPE RFTDDIEIGA SVSVDGVCLT VTTIHSPVLI        60
     DFDVMLPSLR ITTLADLATG ARVNVERAAK DGAEIGGHPL SGHVDFTGTI AHIASSEHNR       120
     MIRIGVPAEF KRYVFAKGYI AINGCSLTVS DVNRDEGWFD VWLIPETRRA TTFDAKGVDD       180
     KVNIEIERST QVVVDTIRES VKETLGELNG VVTALLAEKG IDIEELLARN VARLPKQ          237
//

If you have problems or comments...

PBIL Back to PBIL home page