(data stored in ACNUC1104 zone)

EMBL: CP000959.PE541

CP000959.PE541       Location/Qualifiers
FT   CDS             complement(637542..638120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3730"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3730"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92882"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4V8"
FT                   /protein_id="ACA92882.1"
FT                   /translation="MTLDDFLTEAKRLARPSRQYRFADDGEPVTGYWHGVDAGALCISV
FT                   ERDGVWLNVCLDESGTSGRVETATQPVRSDRPLCRSDAMSLPSVDAVFRFGSAAIGAYL
FT                   DAHGWQRDWGFNGNFKGAAAHDYEREWMAQCPLYTGGVVAVAGGWNMPWPEDDELDDRE
FT                   LVLWTFEASEPWVEVFSDGSRYSVIQRIT"
     MTLDDFLTEA KRLARPSRQY RFADDGEPVT GYWHGVDAGA LCISVERDGV WLNVCLDESG        60
     TSGRVETATQ PVRSDRPLCR SDAMSLPSVD AVFRFGSAAI GAYLDAHGWQ RDWGFNGNFK       120
     GAAAHDYERE WMAQCPLYTG GVVAVAGGWN MPWPEDDELD DRELVLWTFE ASEPWVEVFS       180
     DGSRYSVIQR IT                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page