(data stored in ACNUC1104 zone)

EMBL: CP000959.PE544

CP000959.PE544       Location/Qualifiers
FT   CDS             complement(640729..643038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3733"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region ATPase domain protein; Hpt
FT                   domain protein; KEGG: bur:Bcep18194_B2304 CheA signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3733"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92885"
FT                   /db_xref="GOA:B1K4W1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4W1"
FT                   /protein_id="ACA92885.1"
FT                   /translation="MSGDDDLSHLSLLELYREETRTQTQALSERLLALESGEPDAVALE
FT                   ACMRAAHSLKGAARIVGVPLGVEIAGRMEECFVAAQAGTIALTATHVDVLLAGVDLLVR
FT                   VGDPQGQPVSQTEIDVFAAALTGADGAQTMQAPAAAPPPVPPSFAPYRDHDGAANEPVG
FT                   ASAAVPPLAVSGAVPHPAQAGRVSGAGAMRRVRADTLNRLLSLSGESLVESRWLKPFAE
FT                   SMLRVKRAQRDAARSLDLMVEQFADDLDAGMLASMNEVRHMLNDLQRSLAERMDEFDRF
FT                   ERRSTHIAEQLYDEALQCRMRPFGDATRAYPRIVRDLARSLGKQVRFSIVGEGTQVDRD
FT                   ILDLLDAPLGHLLRNAIDHGVDSPDARHARGKPAEASVTLEARHSAGSLLVSVIDDGPG
FT                   VDMDALRAAVVRQRLTDDETAARLSDPELLEFLLLPGFSMRDAVTDVSGRGVGLDAVQE
FT                   MVRGVRGAVRIFNEPGAGMRFVLQLPLTLSVIRSLLVEVGGEPYAFPLAHVRRTLELAH
FT                   DDIDVLEGQPHFPFDGRRVGLVAAHQLLDAGEPDVARASTAVVVVGGEPELYGVAVDRF
FT                   LGERMLVVQPLDSRLHKIQNIAAGALLENGDPVLIVDVEDLIRSVDKLVRGGQLARLTR
FT                   DPQLALADRRRRVLVVDDSLTVRELERKLLEKRGYDVTVAVDGMEGWNAVRSDAFDLVV
FT                   TDVDMPRMDGIELVTLIKGDPMLKRVPVMIVSYKDRDEDRRRGLDAGADYYLAKSSFHD
FT                   EALLDAVHDLIGDARG"
     MSGDDDLSHL SLLELYREET RTQTQALSER LLALESGEPD AVALEACMRA AHSLKGAARI        60
     VGVPLGVEIA GRMEECFVAA QAGTIALTAT HVDVLLAGVD LLVRVGDPQG QPVSQTEIDV       120
     FAAALTGADG AQTMQAPAAA PPPVPPSFAP YRDHDGAANE PVGASAAVPP LAVSGAVPHP       180
     AQAGRVSGAG AMRRVRADTL NRLLSLSGES LVESRWLKPF AESMLRVKRA QRDAARSLDL       240
     MVEQFADDLD AGMLASMNEV RHMLNDLQRS LAERMDEFDR FERRSTHIAE QLYDEALQCR       300
     MRPFGDATRA YPRIVRDLAR SLGKQVRFSI VGEGTQVDRD ILDLLDAPLG HLLRNAIDHG       360
     VDSPDARHAR GKPAEASVTL EARHSAGSLL VSVIDDGPGV DMDALRAAVV RQRLTDDETA       420
     ARLSDPELLE FLLLPGFSMR DAVTDVSGRG VGLDAVQEMV RGVRGAVRIF NEPGAGMRFV       480
     LQLPLTLSVI RSLLVEVGGE PYAFPLAHVR RTLELAHDDI DVLEGQPHFP FDGRRVGLVA       540
     AHQLLDAGEP DVARASTAVV VVGGEPELYG VAVDRFLGER MLVVQPLDSR LHKIQNIAAG       600
     ALLENGDPVL IVDVEDLIRS VDKLVRGGQL ARLTRDPQLA LADRRRRVLV VDDSLTVREL       660
     ERKLLEKRGY DVTVAVDGME GWNAVRSDAF DLVVTDVDMP RMDGIELVTL IKGDPMLKRV       720
     PVMIVSYKDR DEDRRRGLDA GADYYLAKSS FHDEALLDAV HDLIGDARG                   769
//

If you have problems or comments...

PBIL Back to PBIL home page