(data stored in ACNUC1104 zone)

EMBL: CP000959.PE546

CP000959.PE546       Location/Qualifiers
FT   CDS             complement(644207..645619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3735"
FT                   /product="MCP methyltransferase, CheR-type with Tpr
FT                   repeats"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   bur:Bcep18194_B2306 MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3735"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92887"
FT                   /db_xref="GOA:B1K4W3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4W3"
FT                   /protein_id="ACA92887.1"
FT                   /translation="MSESRFRGWLLRETGIDPDSLGNDFLMRALADRVHALQADGERVP
FT                   AAARPPVTPEALDAYWQQLNASADERRALIELFVVPETWFFRDREAFATLARLAAERLA
FT                   AMPGRVIRVLSAPCSTGEEPYSAAMALLDAGLEPASFTIDAIDLSARAIEQARLGCYGR
FT                   NAFRGTATEFRTRYFTPTRDGWLLDERVRACVQFSHANLVEPVADTGIRYDFVFCRNVL
FT                   IYFDRDAQDRVIRSLDARLADDGMLFVGPAETGVAMRHGMRSARVPLAFAFHREPAGAA
FT                   ADACAARPAAPLSAAAPYPGAERFTVAPLAAPRPVLAVAPPAWLGDVRQPFAVPLPAVT
FT                   TAAIDARADLAVAAAAAAAPANDGIAPTLDEAPTLEDAQALANAGALDEAERVLAQFSA
FT                   RVGPHADAFYLNGLIADARGRAAEASDFYRKALYLRPTHHEALTHLATLLDVGGDRAGA
FT                   QWLLERARRSAG"
     MSESRFRGWL LRETGIDPDS LGNDFLMRAL ADRVHALQAD GERVPAAARP PVTPEALDAY        60
     WQQLNASADE RRALIELFVV PETWFFRDRE AFATLARLAA ERLAAMPGRV IRVLSAPCST       120
     GEEPYSAAMA LLDAGLEPAS FTIDAIDLSA RAIEQARLGC YGRNAFRGTA TEFRTRYFTP       180
     TRDGWLLDER VRACVQFSHA NLVEPVADTG IRYDFVFCRN VLIYFDRDAQ DRVIRSLDAR       240
     LADDGMLFVG PAETGVAMRH GMRSARVPLA FAFHREPAGA AADACAARPA APLSAAAPYP       300
     GAERFTVAPL AAPRPVLAVA PPAWLGDVRQ PFAVPLPAVT TAAIDARADL AVAAAAAAAP       360
     ANDGIAPTLD EAPTLEDAQA LANAGALDEA ERVLAQFSAR VGPHADAFYL NGLIADARGR       420
     AAEASDFYRK ALYLRPTHHE ALTHLATLLD VGGDRAGAQW LLERARRSAG                  470
//

If you have problems or comments...

PBIL Back to PBIL home page