(data stored in ACNUC1104 zone)

EMBL: CP000959.PE547

CP000959.PE547       Location/Qualifiers
FT   CDS             complement(645622..646134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3736"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: bur:Bcep18194_B2307
FT                   CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3736"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92888"
FT                   /db_xref="GOA:B1K4W4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4W4"
FT                   /protein_id="ACA92888.1"
FT                   /translation="MTRADPQNGAHALFLMFELDGERYALDAAGIDEVLPLAVMKAVPG
FT                   APDWIAGLLMRGAQPVPVIDVPMLALGRRAQALRSTRLVMVRHRAGHADGERTIGLIVE
FT                   RATQTMRIDRAAFRASGISTARTRWLGRVANTPDGVVQQVSVPDLVDDVARLYLFDGLP
FT                   GHGEESA"
     MTRADPQNGA HALFLMFELD GERYALDAAG IDEVLPLAVM KAVPGAPDWI AGLLMRGAQP        60
     VPVIDVPMLA LGRRAQALRS TRLVMVRHRA GHADGERTIG LIVERATQTM RIDRAAFRAS       120
     GISTARTRWL GRVANTPDGV VQQVSVPDLV DDVARLYLFD GLPGHGEESA                  170
//

If you have problems or comments...

PBIL Back to PBIL home page