(data stored in ACNUC1104 zone)

EMBL: CP000959.PE552

CP000959.PE552       Location/Qualifiers
FT   CDS             complement(652819..654459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3741"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: bur:Bcep18194_B2312 acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3741"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92893"
FT                   /db_xref="GOA:B1K4W9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4W9"
FT                   /protein_id="ACA92893.1"
FT                   /translation="MKASDLFVKALEAEGVEYVFGIPGEENLDLLESLRRSKIKLVLTR
FT                   HEQAAGFMAATYGRLTGRTGVCLATLGPGATNFVTAAAYAQLGGMPMLMITGQKPIKSS
FT                   KQGHFQIVDVVDMMQPLTKFTRQIVSIGNIPSAVREAFRRAEEERPGAAHLELPEDIAH
FT                   EEGDGKPIPRSYSRRPVAEEKAVAHAVDAIQAARHPLLMIGAGGNRKTTCKMLLEFVDK
FT                   TGIPFFTTQMGKGVIDETHPLWLGNATLSDGDFVHRAIEQADCIINVGHDVIEKPPFFM
FT                   RTDDKTVIHVNFLGAQVDPVYFPQIEVVGDIANAVWQMKEALTPQSHWDFERFKMIKAH
FT                   FDAHLEKGQHDPRFPMYPVRIVNDLYNALPVDGIVCLDNGMYKIWFARYWRAHEPNSLL
FT                   LDNALASMGAGLPSAIATKIVHPQRKVIAVCGDGGFMMNSQELETAVRLKLDIVVMILR
FT                   DDAFGMIRWKQENMNFPDFAMTLQNPDFVSYAQSYGAHGHRVESADDLEPLLRECFSSP
FT                   GVHVIDVPIDYSDNERVLNREIKRLSAQL"
     MKASDLFVKA LEAEGVEYVF GIPGEENLDL LESLRRSKIK LVLTRHEQAA GFMAATYGRL        60
     TGRTGVCLAT LGPGATNFVT AAAYAQLGGM PMLMITGQKP IKSSKQGHFQ IVDVVDMMQP       120
     LTKFTRQIVS IGNIPSAVRE AFRRAEEERP GAAHLELPED IAHEEGDGKP IPRSYSRRPV       180
     AEEKAVAHAV DAIQAARHPL LMIGAGGNRK TTCKMLLEFV DKTGIPFFTT QMGKGVIDET       240
     HPLWLGNATL SDGDFVHRAI EQADCIINVG HDVIEKPPFF MRTDDKTVIH VNFLGAQVDP       300
     VYFPQIEVVG DIANAVWQMK EALTPQSHWD FERFKMIKAH FDAHLEKGQH DPRFPMYPVR       360
     IVNDLYNALP VDGIVCLDNG MYKIWFARYW RAHEPNSLLL DNALASMGAG LPSAIATKIV       420
     HPQRKVIAVC GDGGFMMNSQ ELETAVRLKL DIVVMILRDD AFGMIRWKQE NMNFPDFAMT       480
     LQNPDFVSYA QSYGAHGHRV ESADDLEPLL RECFSSPGVH VIDVPIDYSD NERVLNREIK       540
     RLSAQL                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page