(data stored in ACNUC1104 zone)

EMBL: CP000959.PE554

CP000959.PE554       Location/Qualifiers
FT   CDS             655181..655480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3743"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   bam:Bamb_5507 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3743"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92895"
FT                   /db_xref="GOA:B1K4X1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4X1"
FT                   /protein_id="ACA92895.1"
FT                   /translation="MDKIKTRPWDSAEHLKTEDDMADYFDACLQEAGDDPAFIAHALGV
FT                   IARARGMSQVARDAGLSREGLYKALSHDGNPSFGTILKVIKALGLQLHGAKAAA"
     MDKIKTRPWD SAEHLKTEDD MADYFDACLQ EAGDDPAFIA HALGVIARAR GMSQVARDAG        60
     LSREGLYKAL SHDGNPSFGT ILKVIKALGL QLHGAKAAA                               99
//

If you have problems or comments...

PBIL Back to PBIL home page