(data stored in ACNUC1104 zone)

EMBL: CP000959.PE555

CP000959.PE555       Location/Qualifiers
FT   CDS             complement(655529..656815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3744"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   bur:Bcep18194_B2315 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3744"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92896"
FT                   /db_xref="GOA:B1K4X2"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4X2"
FT                   /protein_id="ACA92896.1"
FT                   /translation="MTPDKALELKRSKRRALWLLLAAVAVFVTTILLPRGPWVDGFKAV
FT                   AEAAMVGALADWFAVVALFRRVPIPFVSRHTEIIPKNKDKIADNLAVFVREKFLGPDAL
FT                   AAQIRQHDPAQKLGAWLGEPANTDALGGYVTKLMSFALDMTDDARIQSFVHDAFRAVID
FT                   RVDLSQSAGAILDTLTKDGRHQALLDDAIEQVVDVLGKEENREVIAGFIVEWLKTQYPK
FT                   VEKIMPTQWFGENGARMLASAVSRVLEGVAADPEHELRQRFDRTVVRLTERLKHDPAFI
FT                   AKGEEIKRYIRDGDAFNEYARDLWDQLRAWLKADLARPDSALHRQAATLGGWLGARLAG
FT                   SPALRASLNEHVERAVHEMAPDFADFLMRHIRDTVRNWDAREMSRQIELNIGKDLQYIR
FT                   INGTLVGGLIGLGLYLVSLVPRWAAGWLH"
     MTPDKALELK RSKRRALWLL LAAVAVFVTT ILLPRGPWVD GFKAVAEAAM VGALADWFAV        60
     VALFRRVPIP FVSRHTEIIP KNKDKIADNL AVFVREKFLG PDALAAQIRQ HDPAQKLGAW       120
     LGEPANTDAL GGYVTKLMSF ALDMTDDARI QSFVHDAFRA VIDRVDLSQS AGAILDTLTK       180
     DGRHQALLDD AIEQVVDVLG KEENREVIAG FIVEWLKTQY PKVEKIMPTQ WFGENGARML       240
     ASAVSRVLEG VAADPEHELR QRFDRTVVRL TERLKHDPAF IAKGEEIKRY IRDGDAFNEY       300
     ARDLWDQLRA WLKADLARPD SALHRQAATL GGWLGARLAG SPALRASLNE HVERAVHEMA       360
     PDFADFLMRH IRDTVRNWDA REMSRQIELN IGKDLQYIRI NGTLVGGLIG LGLYLVSLVP       420
     RWAAGWLH                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page