(data stored in ACNUC1104 zone)

EMBL: CP000959.PE557

CP000959.PE557       Location/Qualifiers
FT   CDS             complement(658177..658503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3746"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bur:Bcep18194_B2323 Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3746"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92898"
FT                   /db_xref="GOA:B1K4X4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4X4"
FT                   /protein_id="ACA92898.1"
FT                   /translation="MTEATLAEWHPLGAFDEFSEDEPAARVAGQKPIAVFRIGDELFAM
FT                   HDLCTHGHARLSEGYVEDGCVECPLHQGLIDIRTGAPKCAPITEPVRTYPIRIVDGQVE
FT                   VNVG"
     MTEATLAEWH PLGAFDEFSE DEPAARVAGQ KPIAVFRIGD ELFAMHDLCT HGHARLSEGY        60
     VEDGCVECPL HQGLIDIRTG APKCAPITEP VRTYPIRIVD GQVEVNVG                    108
//

If you have problems or comments...

PBIL Back to PBIL home page