(data stored in ACNUC1104 zone)

EMBL: CP000959.PE560

CP000959.PE560       Location/Qualifiers
FT   CDS             660514..661473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3749"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bur:Bcep18194_B2326 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3749"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92901"
FT                   /db_xref="GOA:B1K4X7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4X7"
FT                   /protein_id="ACA92901.1"
FT                   /translation="MSPTSFEPLALRAHRLFESRDLDETRERISRVMQPHALLPSGRVR
FT                   GASHMDFVRLGGLGIGTIAFGDAMRVQVDAVDGYYLLMFCLSGQAEVRAMGRQLGVDGQ
FT                   TGVLCAPGERFDAVLSADCEQFVLRIDAATVGALTGDPRAMLDPVLHVSDAALAAWRQQ
FT                   LMLVARSPELLERANANPRVASQLEHLLIDLLIEGHPPSVLQAAHRDPAPGFVRRAQEF
FT                   VDAHYAQPLQLADIVQAANVPERTLRDAFLQFRGMSPMQYLRATRLAHARELLRGAASD
FT                   RRIADIALDCGFTHLGRFAIAYREKFGESPSETLDARR"
     MSPTSFEPLA LRAHRLFESR DLDETRERIS RVMQPHALLP SGRVRGASHM DFVRLGGLGI        60
     GTIAFGDAMR VQVDAVDGYY LLMFCLSGQA EVRAMGRQLG VDGQTGVLCA PGERFDAVLS       120
     ADCEQFVLRI DAATVGALTG DPRAMLDPVL HVSDAALAAW RQQLMLVARS PELLERANAN       180
     PRVASQLEHL LIDLLIEGHP PSVLQAAHRD PAPGFVRRAQ EFVDAHYAQP LQLADIVQAA       240
     NVPERTLRDA FLQFRGMSPM QYLRATRLAH ARELLRGAAS DRRIADIALD CGFTHLGRFA       300
     IAYREKFGES PSETLDARR                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page