(data stored in ACNUC1104 zone)

EMBL: CP000959.PE564

CP000959.PE564       Location/Qualifiers
FT   CDS             664822..665955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3753"
FT                   /product="muconate and chloromuconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /note="KEGG: bur:Bcep18194_B2328 muconate cycloisomerase;
FT                   TIGRFAM: muconate and chloromuconate cycloisomerase; PFAM:
FT                   Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3753"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92905"
FT                   /db_xref="GOA:B1K4Y1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Y1"
FT                   /protein_id="ACA92905.1"
FT                   /translation="MIATAATIERIDTLLVDVPTIRPHKLSVATMNCQTLVLVRVRCTD
FT                   GIEGVGEATTIGGLAYGEESPESIKVNIDTYFAPLLQGLDATRPGAALARARKLFQGNR
FT                   FAKCAIETALFDAQARRLGVPLSELFGGRRTDTVDVAWTLASGDTQRDIAEAEAMLDAR
FT                   RHRAFKLKIGSNAVADDVAHVVAIKRALGERGDVRVDVNQAWSETDAIWAGARLADAGV
FT                   SLVEQPIAATNRAGLKRLTQLAQVPIMADEALHGPVDAFALAQDRAADVFAVKIAQSGG
FT                   LQGAASVASIAAAAGIELYGGTMLEGAAGTMASAQLFSTFDSLKWGTELFGPLLLTEEI
FT                   LVEPLRYEDFKLHLPATPGLGITFDWARIERMRRGAR"
     MIATAATIER IDTLLVDVPT IRPHKLSVAT MNCQTLVLVR VRCTDGIEGV GEATTIGGLA        60
     YGEESPESIK VNIDTYFAPL LQGLDATRPG AALARARKLF QGNRFAKCAI ETALFDAQAR       120
     RLGVPLSELF GGRRTDTVDV AWTLASGDTQ RDIAEAEAML DARRHRAFKL KIGSNAVADD       180
     VAHVVAIKRA LGERGDVRVD VNQAWSETDA IWAGARLADA GVSLVEQPIA ATNRAGLKRL       240
     TQLAQVPIMA DEALHGPVDA FALAQDRAAD VFAVKIAQSG GLQGAASVAS IAAAAGIELY       300
     GGTMLEGAAG TMASAQLFST FDSLKWGTEL FGPLLLTEEI LVEPLRYEDF KLHLPATPGL       360
     GITFDWARIE RMRRGAR                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page