(data stored in ACNUC1104 zone)

EMBL: CP000959.PE565

CP000959.PE565       Location/Qualifiers
FT   CDS             665988..666890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3754"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /note="TIGRFAM: catechol 1,2-dioxygenase; PFAM: intradiol
FT                   ring-cleavage dioxygenase; Catechol dioxygenase domain
FT                   protein; KEGG: bam:Bamb_5498 catechol 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3754"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92906"
FT                   /db_xref="GOA:B1K4Y2"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR012801"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Y2"
FT                   /protein_id="ACA92906.1"
FT                   /translation="MNKQAIDALLKTFDDAAEKPGNPRVRAIVNRIVKDICYTIEDFDV
FT                   QPSEFWTALNYLNEAGREFGLIAAGLGLERFLDVRMDEAEAKAGIQGGTPRTIEGPLYV
FT                   AGAPESVGHARLDDGTDPGQTLIMRGRVLGQDGAPLANALVEVWHANHLGNYSYFDASQ
FT                   PAFNLRRSIRTDAEGRYSFRSVLPVGYSVPPGSKTEQLLDQLGRHGHRPAHIHFFVSAD
FT                   GYRKLTTQINIDGDPHLWDDFAFATRDGLIPPVRQAEGAEGKPYGVDGQFALIDFDFSL
FT                   LKDKQDVPGSEVERARAQA"
     MNKQAIDALL KTFDDAAEKP GNPRVRAIVN RIVKDICYTI EDFDVQPSEF WTALNYLNEA        60
     GREFGLIAAG LGLERFLDVR MDEAEAKAGI QGGTPRTIEG PLYVAGAPES VGHARLDDGT       120
     DPGQTLIMRG RVLGQDGAPL ANALVEVWHA NHLGNYSYFD ASQPAFNLRR SIRTDAEGRY       180
     SFRSVLPVGY SVPPGSKTEQ LLDQLGRHGH RPAHIHFFVS ADGYRKLTTQ INIDGDPHLW       240
     DDFAFATRDG LIPPVRQAEG AEGKPYGVDG QFALIDFDFS LLKDKQDVPG SEVERARAQA       300
//

If you have problems or comments...

PBIL Back to PBIL home page