(data stored in ACNUC1104 zone)

EMBL: CP000959.PE569

CP000959.PE569       Location/Qualifiers
FT   CDS             669327..669731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3758"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3758"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92910"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Y6"
FT                   /protein_id="ACA92910.1"
FT                   /translation="MFQASAFDPEQPGFNPVHFERAAQRAVVDLQRVAGGPAQRALGLR
FT                   RRTHPAAVRTMSWQALLNVEELAFSNPGFLNRNDPAVVDAFIRLRGSRLVAADVEEPVD
FT                   WRRDDDDLPAIYLIVKAMLEAEEEERAEAA"
     MFQASAFDPE QPGFNPVHFE RAAQRAVVDL QRVAGGPAQR ALGLRRRTHP AAVRTMSWQA        60
     LLNVEELAFS NPGFLNRNDP AVVDAFIRLR GSRLVAADVE EPVDWRRDDD DLPAIYLIVK       120
     AMLEAEEEER AEAA                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page