(data stored in ACNUC1104 zone)

EMBL: CP000959.PE570

CP000959.PE570       Location/Qualifiers
FT   CDS             complement(669916..671949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3759"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein; KEGG:
FT                   bur:Bcep18194_B2335 NADH/flavin oxidoreductase/NADH
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3759"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92911"
FT                   /db_xref="GOA:B1K4Y7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Y7"
FT                   /protein_id="ACA92911.1"
FT                   /translation="MTTPFPHLLAPLDLGFTTLKNRVLMGSMHTGLEDSRKTLPRLAEY
FT                   FAERARGGVGLIVTGGFAPNVAGWTKPFGGTLMTSAAARRHREITGAVHAEDGKIALQI
FT                   LHTGRYGYHPFAVAPSKIKSPISPFAPHELSARGVERQIRAFVRCATLAREAGYDGVEI
FT                   MGSEGYLINQFISMHTNKRTDQWGGSYENRIRLPIEIVERTREAVGRDFILIYRLSMLD
FT                   LIPDGSDWSETVQLAKAVERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGE
FT                   VGIPLVTTNRINRPEVAEQILADGCADMVSMARPLLADAEFVVKAAQGRADEINTCIGC
FT                   NQACLDHAFKNKIASCLLNPRACHETELKYTPAPQPKRIAVVGAGPAGLACSTVLAQRG
FT                   HQVDLFDGAAEIGGQFNMAKRIPGKEEFHEALSYFGRQVELTGVKLHLNRRVDASHLIA
FT                   GGYDEIVLATGVAPRDPKIPGQDGPNVLSYIDVLAGKQRVGRRVAVVGAGGIGFDVAEY
FT                   LVQDGESPALDLDEWKAEWGVTDPATTRGGVTRAQVSAPAREVTLLQRKAAPLGKGLGK
FT                   TTGWIHRATLKMKQVKMIGGVNYERIDAGGLHVSYGEQRTDHELIEADTIVLCTGQEPQ
FT                   RALLAPLQAAGRSVHLIGGAELAAELDAKRAIDQGARLAARL"
     MTTPFPHLLA PLDLGFTTLK NRVLMGSMHT GLEDSRKTLP RLAEYFAERA RGGVGLIVTG        60
     GFAPNVAGWT KPFGGTLMTS AAARRHREIT GAVHAEDGKI ALQILHTGRY GYHPFAVAPS       120
     KIKSPISPFA PHELSARGVE RQIRAFVRCA TLAREAGYDG VEIMGSEGYL INQFISMHTN       180
     KRTDQWGGSY ENRIRLPIEI VERTREAVGR DFILIYRLSM LDLIPDGSDW SETVQLAKAV       240
     ERAGATIINT GIGWHEARVP TIATSVPRGA FAWVTKKMKG EVGIPLVTTN RINRPEVAEQ       300
     ILADGCADMV SMARPLLADA EFVVKAAQGR ADEINTCIGC NQACLDHAFK NKIASCLLNP       360
     RACHETELKY TPAPQPKRIA VVGAGPAGLA CSTVLAQRGH QVDLFDGAAE IGGQFNMAKR       420
     IPGKEEFHEA LSYFGRQVEL TGVKLHLNRR VDASHLIAGG YDEIVLATGV APRDPKIPGQ       480
     DGPNVLSYID VLAGKQRVGR RVAVVGAGGI GFDVAEYLVQ DGESPALDLD EWKAEWGVTD       540
     PATTRGGVTR AQVSAPAREV TLLQRKAAPL GKGLGKTTGW IHRATLKMKQ VKMIGGVNYE       600
     RIDAGGLHVS YGEQRTDHEL IEADTIVLCT GQEPQRALLA PLQAAGRSVH LIGGAELAAE       660
     LDAKRAIDQG ARLAARL                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page