(data stored in ACNUC1104 zone)

EMBL: CP000959.PE573

CP000959.PE573       Location/Qualifiers
FT   CDS             673842..674444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3762"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_4968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3762"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92914"
FT                   /db_xref="GOA:B1K4Z0"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Z0"
FT                   /protein_id="ACA92914.1"
FT                   /translation="MTNHDMQIVSGRVTAISQQSIETKVWSNNLGTTTQSIEEITLKLD
FT                   SLASPLVFRTNRTTRLFIADGDRLNVAYADAQDRQFVYGIRNMTDGSAYLLRPAKVAGA
FT                   RADLFVMLICVIGAAVVSGIVSAVTLSMESTFDVFALISANVIGLCVLSAILRILFGVI
FT                   VWPEIRRLAQPGGKREMNAAAQALSLTQEETRHVRFI"
     MTNHDMQIVS GRVTAISQQS IETKVWSNNL GTTTQSIEEI TLKLDSLASP LVFRTNRTTR        60
     LFIADGDRLN VAYADAQDRQ FVYGIRNMTD GSAYLLRPAK VAGARADLFV MLICVIGAAV       120
     VSGIVSAVTL SMESTFDVFA LISANVIGLC VLSAILRILF GVIVWPEIRR LAQPGGKREM       180
     NAAAQALSLT QEETRHVRFI                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page