(data stored in ACNUC1104 zone)

EMBL: CP000959.PE574

CP000959.PE574       Location/Qualifiers
FT   CDS             complement(674544..675023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3763"
FT                   /product="protein of unknown function DUF126"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   bur:Bcep18194_B2339 protein of unknown function DUF126"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3763"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92915"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Z1"
FT                   /protein_id="ACA92915.1"
FT                   /translation="MTETTGTFLTGDTLVPGSACARPFVLDKPLSFWGGYDSGAGRIVD
FT                   RGHPQAGASLAGKVMVMPHAKGSSSSSSVLAEAVRNGTGPVGIVLKERDLIISIGAIVA
FT                   AELYAIAVPVVCVSDDVYDAIVAATGDVRIEAGEGDGGARIYLGADARSGGSGLT"
     MTETTGTFLT GDTLVPGSAC ARPFVLDKPL SFWGGYDSGA GRIVDRGHPQ AGASLAGKVM        60
     VMPHAKGSSS SSSVLAEAVR NGTGPVGIVL KERDLIISIG AIVAAELYAI AVPVVCVSDD       120
     VYDAIVAATG DVRIEAGEGD GGARIYLGAD ARSGGSGLT                              159
//

If you have problems or comments...

PBIL Back to PBIL home page